PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g044450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 187aa    MW: 21205.3 Da    PI: 8.7412
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g044450.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.21.1e-1127942897
                    --..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3 28 gkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                    ++k +  +++l+de+gr  +++l+y k+s+++  ++GW+ F+  ng k+g f+ + l++ +++++v+++f
  Csa11g044450.1 27 LSKLC-NEIILMDEKGRPSKIQLCYHKSSNSFCASRGWRAFCCMNGHKTGCFLKIVLVH-NGKTPVLRIF 94
                    55544.59************************************************998.6777999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010190.0014397IPR003340B3 DNA binding domain
SuperFamilySSF1019361.63E-92692IPR015300DNA-binding pseudobarrel domain
PfamPF023624.3E-102894IPR003340B3 DNA binding domain
CDDcd100174.14E-92995No hitNo description
Gene3DG3DSA:2.40.330.101.2E-83192IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MSCCEILYSQ KDEEDNKKKT GKTSIDLSKL CNEIILMDEK GRPSKIQLCY HKSSNSFCAS  60
RGWRAFCCMN GHKTGCFLKI VLVHNGKTPV LRIFPLERDE DGIGKYSEKI KQEVEHESAK  120
DEKNVESLSL SNNSSFVVSV TVSNLREDRL YLSIKLSRSN IPEDKISREK FNTQPGKNMG  180
VMFKIQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0464322e-64AB046432.1 Arabidopsis thaliana DNA, chromosome 5 centromere region, clone:F22D12.
GenBankCP0026882e-64CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankF18O92e-64AF296831.1 Arabidopsis thaliana BAC F18O9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010445497.11e-104PREDICTED: LOW QUALITY PROTEIN: B3 domain-containing protein REM-like 3
SwissprotF4KFT61e-55REML3_ARATH; B3 domain-containing protein REM-like 3
TrEMBLR0F3W14e-58R0F3W1_9BRAS; Uncharacterized protein
STRINGAT5G32460.13e-53(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G32460.13e-49B3 family protein